PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3745_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9198.79 Da    PI: 10.7524
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3745_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.44.6e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   k+i+n + rqvtfskRr g++KKAeELSvLCdaev viifs tgkl+eyss
  Neem_3745_f_1  9 KKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFEYSS 59
                   68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.562161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-28170IPR002100Transcription factor, MADS-box
CDDcd002651.61E-34260No hitNo description
PRINTSPR004042.7E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAEELSVLCD AEVGVIIFSA TGKLFEYSSS  60
RSLLHPVLNS AEPFPSKRPY L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-17177179Myocyte-specific enhancer factor 2B
1tqe_R1e-17177179Myocyte-specific enhancer factor 2B
1tqe_Q1e-17177179Myocyte-specific enhancer factor 2B
1tqe_P1e-17177179Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386424.13e-35hypothetical protein POPTR_0002s10570g, partial
RefseqXP_011016930.16e-34PREDICTED: MADS-box protein JOINTLESS
SwissprotO827943e-33AGL24_ARATH; MADS-box protein AGL24
TrEMBLU5GPC13e-35U5GPC1_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0002s10570.18e-35(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.12e-34AGAMOUS-like 24